Одну секунду
Что-то сучилось. Попробуйте еще раз.
CSC e Governance Services смотреть последние обновления за сегодня на .
By using Amazon Web Services (AWS), CSC E-Governance Services India Ltd elastically scales to meet user demand across thousands of common services centres across India. CSC E-Governance Services India Ltd was set up by the Ministry of Electronics & IT in India to oversee the implementation of common service centres (CSCs), which are access points for delivery of various electronic services to villages in India. With Amazon EC2, Amazon Elastic Block Storage, Amazon RDS, and Amazon S3, CSC E-Governance Services India Ltd can scale instantly to provide seamless service for users logging onto the system.
Agreement Signing Between CSC e-Governance Services India Limited & HDFC Bank
CSC Registration Online CSC News Update CSC Kya Hai CSC New Update Digital India CsC Bihar Vasudha Kendra
Digital Innovation & Cyber Security Summit 2019: Dr Dinesh Tyagi, CEO, CSC e-Governance Services India Limited Visit Website: 🤍 Subscribe for Videos: 🤍 Facebook: 🤍 Linkedin: 🤍 Twitter: 🤍
CSC Registration 2023 | How to apply for csc center online | csc id password kaise banaye , csc center kaise khole 2023 This video is about How to apply for csc center online However, you can visit the official website of the CSC (Common Service Center) to stay updated on the registration process or contact their customer support for more information. To apply for a CSC center online, you can follow these steps: 1. Visit the official website of CSC. 🤍 2. Click on the 'For CSCs' tab and select 'Registration' from the drop-down menu. 3. Click on 'New CSC Registration' and select your state and district. 4. Fill in your personal and contact details in the registration form, including your name, mobile number, email ID, and Aadhaar number. 5. Upload the required documents, such as a scanned copy of your Aadhaar card, a passport-sized photograph, and your signature. 6. Submit the application and pay the registration fee as per the guidelines. 7. After verification and approval of your application, you will receive login details (CSC Id and password) to access the portal. To create a CSC ID password, follow these steps after receiving the login details: 1. Go to the CSC login page and enter your CSC ID and password. 2. Once logged in, go to the 'Profile' section and click on 'Change Password.' 3. Enter the new password and confirm it. 4. Click on 'Submit' to save the changes. Make sure to keep your CSC ID and password safe and secure to avoid any misuse. Important Link Topics covered this video csc id kaise banaye,csc registration 2023, csc id kaise le, how to apply csc registration 2023, csc center kaise khole, csc registration kaise kare, how to apply for csc center online, csc registration, csc id registration, csc id password kaise milega, csc id kaise banaye 2023, how to apply csc registration 2023, csc id registration full process, new csc registration,csc registration 2023, csc center kaise khole 2023, csc id registration 2023 Join this channel to get access to perks: 🤍 Keep Supporting Us :- Website : 🤍 Email : SarkariDNAlive🤍gmail.com Social Media Handles * Follow us on: Telegram : 🤍 Instagram: 🤍 Twitter: 🤍 Facebook: 🤍 My Vlog channel 🤍 Career DNA channel 🤍 MoneyEnroll channel 🤍 Disclaimer- The video is made solely for educational purposes and is not created with an intent to harm, injure or defame any person, body of persons, association, company or anyone. Details in the video like Home address, Email addresses, Sign-in credentials, Phone numbers, Passport number, Bank account information are demo do not belong to a real human. Some contents are used for educational purposes under fair use. Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use. All credit for copyright material used in the video goes to the respected owner.This video is not intended to spread rumours, offend, or hurt the sentiments of any religion, communities or individuals, or to bring disrepute to any person (living or dead). The viewer should always do their diligence and anyone who wishes to apply the ideas contained in the video takes full responsibility for it. Also, it is done at their own risk and consequences. The material contained in this video cannot replace or substitute for the services of trained professionals in any field including, but not limited to, financial, medical, psychological or legal matters. Nasim Ali Khan and the producers do not take responsibility for any direct, indirect, implied, punitive, special, incidental, or other consequential damages arising directly or indirectly on account of any actions taken based on the video. Nasim Ali Khan and the producers of the video disclaim any kind of claim of libel, slander or any other kind of claim or suit of any sort. Viewers discretion is advised.
CSC Services : Digital Seva Portal - how many service in csc | csc kaise use kare | csc 2020 hindi csc means common service center jaha aapko bahut sari services milti hai aur aap ek shop open karke public ko woh services dekar achi income kar sakte hai. csc me digital seva portal diya jata hai jisme har tarah ki services hoti hai jaise birth certificate banana, kisan credit card bnana, bill pay karna etc. is video me aap dekhenge ki digital seva portal kaise use kare, csc me kitni services milti hai, digital seva portal login kaise kare. Buy Domain: 🤍 Buy Hostinger Hosting with free domain: 🤍 Buy A2hosting: 🤍?aid=5c43ffc791093&bid=39960867&chan=ishan Buy Hostgator Hosting: 🤍 Official Website: 🤍 Email: help🤍ishanguru.com Follow 🤍Twitter: 🤍 Follow 🤍Instagram: 🤍 Join Our Telegram Channel : 🤍 My Mic: 🤍 My Camera: 🤍 My Monitor: 🤍 topics: csc all services 2020,csc all services list,csc services,how many services in csc,csc digipay kaise use kare,csc kaise use kare,csc portal services,csc portal se pan card kaise banaye,csc portal registration,digital seva,digital seva portal registration,digital seva id kaise banaye,digital seva portal kaise use kare,how to use digital seva portal,csc services in hindi,csc benefits in hindi,csc in hindi jankari,digital seva add operator,ishan guru,csc ishan
What is e governance Electronic governance
CSC registration 2023 start ho chuke hai, csc id ke liye online apply kar sakte hai. is video me csc center apply karne ka complete process dikhaya gya hai. csc id lene le liye tec certificate number mandatory hai. tec certificate kaise le ye bhi is video me dikhaya gya hai CSC Registration 2023: 🤍 TEC Certificate website: 🤍 TEC Certificate aise milega: 🤍 TEC Exam Live: 🤍 CSC (Common service center) ek government facility hai jisse public ko government aur private scheme ki facility dekar paise kama sakte hai. csc center kaise khole, csc id kaise milegi, csc ke liye kaise apply kare, ye sab is video me dekhiye CSC Registration 2023 | How to apply for csc center online | csc id password kaise milega | Guide Follow 🤍Twitter: 🤍 Follow 🤍Instagram: 🤍 Join Our Telegram Channel : 🤍 My Mic: 🤍 My Camera: 🤍 My Monitor: 🤍 tags for reference: csc registration 2023,how to apply for csc center online,csc id kaise banaye,csc id kaise le,csc id password kaise milega,tec certificate csc,tec certificate download,csc registration kaise kare,how to apply csc registration 2023,tech news,technology,common service centre kaise khole,common service center,common service centre,how to open common service centre,how to start csc center,csc registration,csc id registration,csc registration process,ishan guru
CSC JOB NOTIFICATION 2020| LATEST JOB VACANCY FROM CSC E-GOVERNANCE SERVICE INDIA | Click2Devbabu Latest CSC job updates 2020 | New CSC Job info 2020 | Latest CSC job notification 2020| Apply CSC job | CSC Job Vacancy About: Hey friend in this video we discus about the recruitment from CSC e governance service India limited for the designation of State level manager and District Level manager for various states of India. Official Website Link: 🤍 Recruitment Link: 🤍 Apply Online Link: http://52.74.43.195/app/webroot/job-registration/ref/378c1b8a43be81c8f4b55233ba21707b View Latest Playlist for JOB Notification: FREE GOVT JOB: 🤍 FREE POLICE JOB: 🤍 FREE BLOCK JOB: 🤍 FREE DEO JOB: 🤍 ODISHA PANCHAYAT LEVEL JOB: 🤍 ODISHA POSTAL JOB: 🤍 BANK JOB: 🤍 NALCO JOB: 🤍 8th PASS JOB: 🤍 NAVY JOB: 🤍 TEACHER JOB: 🤍 Assistant Job: 🤍 BANK JOB: 🤍 Govt JOB: 🤍 Odisha Job: 🤍 Subscribe This Channel: 🤍 Share This Video:🤍 Like This Video: 🤍 Comment Here: 🤍 .......................................................... Connect With Social Network: .......................................................... Tweeter Zone : 🤍 Facebook Zone: 🤍 Instagram Zone: 🤍 Official Website Zone: 🤍 ................................................................................ Buy Best and Powerful Domain & Hosting For your Business and personal USE CODE: Coupon: BR20HALFAFF 50% OFF ON HOSTING: 🤍 Free Domain: 🤍 Free SSL: 🤍 Free Hosting: 🤍 Best Hosting: 🤍 Best Hosting Backup: 🤍 Lower Hosting : 🤍 .............................................................................................................. As we all know This time is for follow Social Distancing and Home Quarantine. So just Obey the government rules for COVID-19 Stay Safe, Make safe to Other Stay at home, Keep Smiling take care of yourself & your family. .......................................................................................................................... Note:-All Are requested to read very carefully the instruction before apply the application for for respective posts vacancies and please visit the official website to get the recruitment notification.This is all about information and you request before proceed must read the notification completely and carefully. .................................................................................................................. Stay Tuned Stay Healthy Stay Wealthy Keep Smiling and Enjoy.Subscribe to this channel and keep loving. Thank You Very Much # CSC JOB NOTIFICATION 2020 # LATEST JOB VACANCY FROM CSC E-GOVERNANCE SERVICE INDIA #NEW JOB VACANCY UPDATES #Latest government job info 2020 # CSC # Common Service Center #Click2devbabu
#Csc #CSCacademy #Cscdigitalplatform
Accelerating Startup Economy!! National #StartupConference presenting achievements & solutions of tech startups has begun at #DIW2022. #IndiasTechade #DigitalIndiaWeek
My New CSC Center Tour Part 2 2022 || Common Service Center || Digital India | My CSC Center Upgade ☺Hello Friends Welcome To RajPut_ComPuters Today I will show you my CSC Center which is at Kanpur Dehat , Uttar Pradesh where i provide digital seva to the village people and tribal people as a CSC VLE. Join my whatsapp group and telegram || Letest Update | vle Support Groups Telegram link - 🤍 Follow Me On Social Media Platforms Instagram. ☑ Instagram 🤍 Facebook ☑ Facebook 🤍 _ Location:- Sadguru Inter College Alampur Sikandra Kanpur Dehat Contect Us - +919559921093 +918726921093 Email - Neerajbabu074🤍gmail.com Do like this video and share with your Friends. and dont forget to subscribe my channel for more video like this. Thanking You. Tags common service center,csc center kaise khole,how to register for common service center,common service center near me,common service center kaise khole,csc center,csc center kaise khole 2022,digital india,csc new service,common service center song,commen service center,common service centers,common services centere,csc aadhar center registration,how to open csc center in hindi,how to apply for csc center online 2021,common service centre #RajPut_ComPuters #My_New_CSC_Center_Tour_2023 #tour #My_New_CSC_Center_Tour_Part_2_2023 My #CSC_Center_Upgade ///////////////////////////////////////////////////////////////////////////////////////////////// || Like || Comment || Share || Subscribe Now || ///////////////////////////////////////////////////////////////////////////////////////////////// Copyright Disclaimer: Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use.
Common Service Centre, CSC e Governance, Tamilnadu CSC Association, tncscvle
This Video gives the information about CSC services and the way of earning Rs.50000 through CSC services. The list of CSC services has been described in the video with the tentative commission. इस वीडियो में CSC की सभी सर्विसेज की जानकारी दी गयी है और आप कैसे पचास हजार रुपए महीना कमा सकते है इस बारे में बताया गया है | How to Register for new CSC center Id: 🤍 How to Apply for IIBF exam for BC/CSP: 🤍
CSC Center Online Registration Complete Process TEC Exam Process & Payments 🤍 Visit Website : 🤍 మీకు ఈ వీడియోలు నచ్చితే LIKE 👍 , Share ☑️ చేయండి , మీ #COMMENTS 💬 ను తెలపండి మరియు #SUBSCRIBE 🔴 చేసుకోండి. Join this channel to get access to perks: 🤍 For More Updates: Be a Lucky Subscriber✔ 👉 Subscribe to TeluguPay Channel ► 🤍 👉 Telegrame : ► 🤍 👉Like us on Facebook: ► 🤍 👉Follow us on Twitter: ► 🤍 ✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴✴ Disclaimer: The video is made solely for educational purposes and is not created with an intent to harm, injure or defame any person, body of persons, association, company or anyone. Details in the video like Home address, Email addresses, Sign-in credentials, Phone numbers, Passport number, Bank account information are demo do not belong to a real human. Some contents are used for educational purposes under fair use. Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use. All credit for copyright material used in the video goes to the respected owner. This video is not intended to spread rumor's, offend, or hurt the sentiments of any religion, communities or individuals, or to bring disrepute to any person (living or dead). The viewer should always do their diligence and anyone who wishes to apply the ideas contained in the video takes full responsibility for it. Also, it is done at their own risk and consequences. The material contained in this video cannot replace or substitute for the services of trained professionals in any field including, but not limited to, financial, medical, psychological or legal matters. Telugu Pay and the producers do not take responsibility for any direct, indirect, implied, punitive, special, incidental, or other consequential damages arising directly or indirectly on account of any actions taken based on the video. Telugu Pay and the producers of the video disclaim any kind of claim of libel, slander or any other kind of claim or suit of any sort. Viewers discretion is advised.
By now, we have 1.3 billion Aadhaar cards. Around 20 billion android apps are downloaded with presence of 300 million smartphones across nation. Seeing the digital map of India, around 270 million plus internet users are from rural India. In terms of Education, according to the current data of NITI Aayog, there are 14 lakh higher education teachers, 30 million higher education students, 8 million school teachers and 260 million school students. To bring quality education to such huge numbers, we require integrated digital education, which will act as a supplementary kind of input. We also require local language teachers for teaching particular skills, which is an adaptive way for students as well as faculty to grow. For digital content delivery, there are also lot of platforms. Most of the educational institutions are actually using it. Adding to that, the Government’s effort in education is in right direction. Speaker: Rishikesh Patankar, COO, CSC e-Governance Services India Ltd Follow us on = Facebook: 🤍 Twitter: 🤍 Instagram: 🤍 Linkedin: 🤍 #ICTAcademyIndia #Skycampus
🤍uccorporation.com
Rishikesh Patankar has more than 20 years of experience including stints at National R & D lab, top universities abroad, and the Indian Navy. He holds three master degrees in Computer Science/and NET qualified. He manages large scale multiple projects in ICT domain. He is a trained Drone Pilot & his area of interest is in the 4 th Industrial Revolution technologies for the benefit of the common man. He is working as Chief Operating Officer in CSC e-Governance Services India Limited, a SPV under Ministry of Electronics & IT looking after education, Skill Development and CSC Academy. For more inspirational and educational content, visit: 🤍
TAMILTECH CSC WHATSAPP GROUP LINK : 🤍 TAMILTECH WATSAPP NUMBER : +91 7094574337 FACE BOOK GROUP LINK : 🤍 CSC TECH REGISTRATION LINK : 🤍 POLICE VERIFICATIN VIDEO LINK : 🤍 helpdesk🤍csc.gov.in | | CSC Registration Home Apply My Account Tools FAQs VLE registration process is being revamped and the applications as per new process will be allowed shortly. However, during the current month we are accepting applications as per the older process only. VLE registration It is a simple and easy process to register as a VLE in the CSC ecosystem. Registration is free of cost. Just fill your details and join the CSC network. Click here to Register Rural Entrepreneurship By becoming a Village Level Entrepreneur (VLE), the user will be able to work on Digital Seva Portal and will be able to deliver various government and non-government services. View Credentials After successful registration and QC, you will be entitled to receive DigiMail and Digital Seva credentials. Click here to view your credentials Track application All the applications undergo a Quality check mechanism. You may keep a track of the status of your application by Clicking Here. What VLE's Says If you are looking to work with us do not hesitate to join us. IMPORTANT LINKS HOME CSC CONNECT DIGIMAIL APPLY MY ACCOUNT EMPLOYEE LOGIN STAY CONNECTED Copyright 2022 CSC e-Governance Services India Limited. All rights reserved. Terms & Conditions Helpline no. : 011 4975 4923 , 011 4975 4924 Ver 2.0.
#newsteptech #cscregistration2023 #cscregistration #digitalseva #cscjobr #cscucl #aadhaar #latestjob #csc #cscnews #csclatestnews #cscupdate मित्रों वीडियोअच्छा लगा हो तो लाइक करें चैनल को सब्सक्राइब करें अपने दोस्तों के पास शेयर करें धन्यवाद. My Instagram Link..... 1- Personal As Sarvesh Pandey 🤍 Adhaar UCL Video Link... 🤍 🤍 🤍 🤍 Other Adhaar Related Important Video Link.... 🤍 🤍 🤍 🤍 मित्रों पहले नंबर का एचपी वाला लैपटॉप मैं यूज करता हूं जो कि i5 है लेकिन यदि आप चाहें तो नीचे वाले लैपटॉप्स को भी परचेस कर सकते हैं जो कम रेट पर उपलब्ध है इन पर भी UCL Work करेगा UCL Compatible Laptop List and Link 1- 🤍 2- 🤍 3- 🤍 4- 🤍 मित्रों यह जीपीएस डिवाइस काफी अच्छा काम कर रहा है यदि आप चाहें तो इसे ट्राई कर सकते हैं GPS Device working with UCL 1- 🤍 अभी इसी Irish इस डिवाइस से सॉफ्टवेयर लॉगिन हो पा रहा है Irish Device For UCL Work 1- 🤍 Finger Print Morpho Device For UCL Work 2- 🤍 Link to Apply for UCL 🤍 Link for Iris EPI-1000 Software 🤍 Link for morpho driver for UCL 🤍
DigiPay - AEPS Banking | CSC E-Governance Services India limited Hi I am Jasraj Welcome to our youtube channel jasolcomputer. About this video - csc E-governance Services India limited #DigiPay #AEPS_Banking #DigiPay_cloud 🤍 Digipay Drivers all 🤍 Digipay updated driver For capture failed error Ydi AAP k digipay m Capture failed. 👆🏻 Ki error AA rhi h. To y file download kre 👆🏻 Jo device use krte ho uski rd service Ko run kre 👆🏻do jisse y solutions ho jayega .👆🏻 Apply Online Pan Card Nsdl | apply online pan card in 3 day पेन कार्ड ऑनलाइन अप्प्लाई कैसे करे 🤍 दोस्तों अब आप ऑनलाइन अपना पेन कार्ड सिर्फ 3 दिन में बना सकते है | Aadhar ekyc se 1 अंगूठे लगाने वाले का पेन कार्ड कैसे बनाये Link - 🤍 Digipay app is available on google play store App Link - 🤍 🤍 This is for morpho user 👆🏻 🤍 This is for mantra user👆🏻 Google Pay - I’m inviting you to use Google Pay, a simple and secure payments app by Google. Here’s my code (280ub)- just enter it before your first transaction. If you send your first payment, you will earn a reward! 🤍 बधाई हो गूगल ने पैमेंट बैंक की सेवाएं भारत में भी सुचारू कर दी है अब आप सभी प्रकार के बेकिंग रिचार्ज इत्यादि ट्रांजेक्शन कर पाएंगे गूगल पे पर एक बार उपयोग करके देखें ऐसा प्लेटफार्म आपको कहीं नहीं मिलेगा Thank you so much.......... ............................................................................................................... Amazon Link usb cable for morpho 1300 e e2 e3 finger print scanner Cable perched - 🤍 Wire for Mantra MFS 100 Fingerprint Scanner Mantra MFS100 USB : 🤍 Tripod and Mobile Clip Bracket 3110 : 🤍 boya by m1 mic. : 🤍 Our Social Links- subscribe this channel Youtube - 🤍youtube.com/user/JASRAJNOKH Email- jasolcomputer2018🤍gmail.com
मित्रों वीडियोअच्छा लगा हो तो लाइक करें चैनल को सब्सक्राइब करें अपने दोस्तों के पास शेयर करें धन्यवाद. My Instagram Link..... 1- Personal As Sarvesh Pandey 🤍 Adhaar UCL Video Link... 🤍 🤍 🤍 🤍 Other Adhaar Related Important Video Link.... 🤍 🤍 🤍 🤍 मित्रों पहले नंबर का एचपी वाला लैपटॉप मैं यूज करता हूं जो कि i5 है लेकिन यदि आप चाहें तो नीचे वाले लैपटॉप्स को भी परचेस कर सकते हैं जो कम रेट पर उपलब्ध है इन पर भी UCL Work करेगा UCL Compatible Laptop List and Link 1- 🤍 2- 🤍 3- 🤍 4- 🤍 मित्रों यह जीपीएस डिवाइस काफी अच्छा काम कर रहा है यदि आप चाहें तो इसे ट्राई कर सकते हैं GPS Device working with UCL 1- 🤍 अभी इसी Irish इस डिवाइस से सॉफ्टवेयर लॉगिन हो पा रहा है Irish Device For UCL Work 1- 🤍 Finger Print Morpho Device For UCL Work 2- 🤍 Link to Apply for UCL 🤍 Link for Iris EPI-1000 Software 🤍 Link for morpho driver for UCL 🤍
#csccenter # CScCenteropening #Easywaymeekosam Part time or Full time job opportunity CSC Center.. opening Free... గవర్నమెంట్ పథకాలతో పాటు అన్ని కంపెనీల ఇన్సూరెన్స్ పాలసీల యొక్క సమాచారాన్ని అత్యంత సరళమైన భాషలో తెలుసుకోవడానికి.... ఇన్సూరెన్స్ మార్కెట్ తెలుగు. కామ్ ని సంప్రదించండి. లింక్ 👇 🤍 Open in CSC OFFICIAL WEBSITE or meseva Center Link : 🤍 Official website: 🤍 1. New Corona Rakshak Insurance Plan Full Details? 🤍 2. Post Office NSC Scheme Details in Telugu? 🤍 3. Pradanamantri SRAM Yogi Maan Dhan Yojana Telugu? 🤍 4. Pradanamantri suraksha Bhima Yojana Telugu? 🤍 5. Maxlife Monthly Advantage income plan? 🤍 6. SBI general insurance company plan? 🤍 7. SBI money Back Plan? 🤍 8. Yedhi Manchidi Endowment? 🤍 9. LIC aadar Stambh Only for male? 🤍 10. LIC micro bachat in Telugu? 🤍 csc registration 2020, csc registration, new csc registration, csc registration apply2020, csc registration how to, csc ,e, csc id 2020, csc id kaise le, how to apply for csc center online 2020, csc center ke liye apply kaise kare, csc intelugu ,csc 2020 new registration, csc 2020 registration, Easy Way Meekosam 🙏🙏🙏 Please like and share.... subscribe for more good plans
CSC e governance services india limited
How to order 1mg health care service in CSC .
CSC Project: 100 Digital Villages Under PMEGP-KVIC | Empowering Rural India Welcome to our YouTube channel, where we bring you the latest updates on the transformative initiatives implemented by the Government of India. In this video, we delve into the impactful CSC Project: 100 Digital Villages, a pioneering endeavor under the Prime Minister's Employment Generation Program (PMEGP) and the Khadi and Village Industries Commission (KVIC). Learn More 👉 🤍 The CSC Project: 100 Digital Villages is an ambitious undertaking aimed at bridging the digital divide and fostering socio-economic development in rural areas across India. Through this project, the government aims to empower the rural population by providing them with access to essential digital services and promoting entrepreneurship at the grassroots level. Under the visionary leadership of Prime Minister Narendra Modi, the PMEGP and KVIC have joined forces to establish digital villages, equipped with state-of-the-art infrastructure and technology. These digital villages act as vibrant hubs, fostering digital literacy, e-governance, and the dissemination of knowledge among the rural populace. Through the implementation of this project, various initiatives have been undertaken to uplift rural communities. The PMEGP offers financial assistance and credit-linked subsidies to aspiring entrepreneurs, enabling them to establish micro-enterprises in their villages. This support helps create employment opportunities, reducing migration from rural to urban areas and fostering sustainable rural development. The KVIC's expertise in promoting Khadi and other village industries plays a crucial role in the project. By leveraging the potential of traditional crafts and indigenous products, the KVIC fosters entrepreneurship and empowers rural artisans, helping them thrive in the digital age. In this video, we explore the key components of the CSC Project: 100 Digital Villages, such as: Setting up digital infrastructure including high-speed internet connectivity, computer centers, and e-learning facilities. Digital literacy programs to empower rural residents with essential digital skills. E-governance services, enabling villagers to access government schemes, banking services, and digital platforms for various needs. Entrepreneurship development programs, fostering local businesses and promoting self-reliance. Promotion of Khadi and village industries, supporting rural artisans and preserving India's rich cultural heritage. Join us in witnessing the incredible impact of the CSC Project: 100 Digital Villages, which is revolutionizing the lives of rural communities and paving the way for a digitally inclusive India. Stay tuned for inspiring success stories, insightful interviews, and updates on the progress of this transformative project. Don't forget to like, share, and subscribe to our channel for more informative videos on government initiatives and socio-economic development. Together, let's empower rural India and create a prosperous future for all. #CSCProject #DigitalVillages #PMEGP #KVIC #RuralDevelopment #DigitalIndia
CSC Registration 2022 CSC ID Kaise Banaye - 🥇PRAKASH LLB🥇 - Description: हेलो दोस्तों मैं हूँ प्रकाश परमार और हमारे YouTube चैनल "PRAKASH LLB" पर आपका बहुत-बहुत स्वागत है. ये चैनल मेरी बहुत सारी Hobbies में से एक हॉबी है. इस चैनल का असल टॉपिक तो लॉ है लेकिन इसके अलावा मै इस चैनल पर काफी सारे टॉपिक्स कवर करता हूँ जैसे टेक्नोलॉजी, एजुकेशन, ऑनलाइन फॉर्म भरना, कंप्यूटर टिप्स एंड एजुकेशन,सरकारी भरती के विडिओ,और सरकारी ओजना के विडिओ, कई सारे सरकारी काम आप घरबेड़े कैसे कर सकते है उसके विडियो, और फाइनेंस. सभी टॉपिक्स पर अलग- अलग तरह की विडियो बनाना मेरा शौक़ है, और इस वीडियोस से कई सारे लोगोकी प्रोब्लम सोल्व हो जाती हें इससे अस्शी बात क्या हो सकती हें इसी लिए दोस्तों आप लोग मुझे सपोर्ट करते रहिये, ताकि मैं अपनी नॉलेज से हर उस व्यक्ति की हेल्प कर सकँक जिसकी हेल्प मै कर सकता हूँ. धन्यवाद जयहिंद 🖍🖌🖊🖋About This Video:🖍🖌🖊🖋 Topics covered this video csc id kaise banaye csc registration 2022 csc registration kaise kare csc id kaise le,csc id kaise banaye 2022 ,csc center kaise khole csc id registration csc id registration 2022 csc id kaise banaye free me 2022 csc center kaise khole 2022 csc registration 2022 free csc id registration full process csc registration,csc id kaise milega ,csc id registration full process 2022 new csc registration csc id kaise banaye 2022 😎📱📱📱Other Social Links:📱📱📱😎 INSTAGRAM : 🤍 FECEBOOK : 🤍 TWITTER : 🤍 LINKEDIN : 🤍 - Disclaimer- Some contents are used for educational purpose under fair use. Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use. All credit for copyright materiel used in video goes to respected owner. 😎CREATE BY : PRAKASH PARMAR😎 #PrakashParmar #PrakashLLB #PRAKASHLLB
csc registration 2023 Complete Live Process | csc center kaise khole 2023 पूरी जानकारी देखें csc registration 2023 | csc center kaise khole | csc center kaise le | csc center kaise khole 2023 | csc center kaise khole 2023 in hindi | how to open csc center 2023 | how to open csc | how to open csc center | csc center ke liye kya kya chahiye | csc center ke liye registration kaise kare | how to apply csc registration 2023 | how to apply csc id & password | csc id kaise banaye | tec certificate registration | tec exam kaise pass kare 2023 | tec exam kaise de | csc center New Channel Link 👇 🤍 Telegram Group👇 🤍 Website👇 🤍 Hi I Am Rahul Raj. Welcome to Our YouTube Channel Online Update STM. About this video- Dosto Aaj Ki Is Video Me Maine Aapko Ye Bataya Hai csc registration 2022 Complete Live Process | csc center kaise khole 2022 पूरी जानकारी देखें Ummeed Hai Aapko Ye Video Bahut Pasand Aayegi .......................Thank you so much... ............... Important Vidoes- आयुष्मान कार्ड का लिस्ट कैसे देखे 👇👇 🤍 प्रधानमंत्री मानधन योजना ऑनलाइन आवेदन करे 👇👇 🤍 जन्म प्रमाण पत्र कैसे बनाये ऑनलाइन 👇👇 🤍 5 वर्ष से अधिक उम्र वाले का जन्म प्रमाण पत्र कैसे बनाये 👇👇 🤍 आधार कार्ड में मोबाइल नंबर कैसे जोड़े 👇👇 🤍 आधार कार्ड में जन्म तिथि कैसे सुधारे 👇👇 🤍 आधार कार्ड में पता कैसे सुधारे👇👇 🤍 पैन कार्ड कैसे बनाये👇👇 🤍 पैन कार्ड कैसे सुधारे 👇👇 🤍 चरित्र प्रणाम पत्र कैसे बनाये 👇👇 🤍 जाति प्रमाण पत्र कैसे बनवाएं 👇👇 🤍 आय प्रमाण पत्र कैसे बनाएं 👇👇 🤍 जाति, आवासीय और आय कैसे Download करें 2021 में 👇👇 🤍 EWS Certificate kaise banaye 👇👇 🤍 बेरोजगारी भत्ता के लिए आवेदन कैसे करें 👇👇 🤍 VOTER ID CARD के लिए ऑनलाइन आवेदन करें 👇 🤍 VOTER ID CARD को डाउनलोड कैसे करें 👇 🤍 VOTER ID CARD कैसे सुधार करें 👇 🤍 Our some other playlist – आधार कार्ड कैसे सुधारें👇 🤍 पैन कार्ड कैसे बनाएं👇 🤍 वोटर कार्ड कैसे बनाएं👇 🤍 Ba Exam की तैयारी कैसे करें👇 🤍 जाति आवासीय आय कैसे बनाएं और डाऊनलोड करें 👇 🤍 Other social links Youtube - 🤍 Facebook- 🤍 Twitter- 🤍 instagram- 🤍 Disclaimer !! Some content is used under fair use for Educational Purposes. Copyright Disclaimer under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favour of fair use. Email- onlineupdatechannel🤍gmail.com Your Quries- CSC Center Kese Open Kare | CSC Ki ID Kese Milegi | CSC Center कैसे खोलें पूरी जानकारी देखें | CSC सेंटर मिलने के बाद जरुरी Settings | CSC Ka ID Password Milne Ke Bad Kya Kare | CSC Services | How To Apply Online For CSC Center 2022 StepByStep | CSC Center Ke Liye Avedan Kese Kare | LIVE CSC TEC Certificate Online Test 2022 StepByStep | TEC Test Kese Pass Kare | How To Apply For CSC Center 2022 Step By Step | CSC जन सेवा केंद्र सेण्टर के लिए ऐसे करें आवेदन | CSC जन सेवा केंद्र खोलें और कमाएं लाखों | Open Your CSC Center & Earn Money 2022 | CSC Center Kese Khole | How To Open CSC Center | How To Get CSC ID Password | How To Pass TEC Course | How To Get TEC Certificate | How To Apply Online For CSC Center 2022 StepByStep | LIVE CSC TEC Certificate Online Test 2022 StepByStep | How To Apply For CSC Center 2022 Step By Step | Open Your CSC Center & Earn Money 2022 | CSC Center Kaise Khole 2022
Tune in for an insightful session with Mr. Ashish Agarwal, Head - Agri & CSC Business, Bajaj Allianz General Insurance and Mr. Atul Mohan, Vice President & Vertical Head - Insurance - CSC e-Governance Services India Limited, as they talk about the growth of insurance through CSC inclusion. Learn how the models under Common Service Centres (CSC) have helped in getting more people under insurance inclusion and thereby secured their future.
हमारे टेलीग्राम ग्रुप से जुड़े- 🤍 E Stamp online Service Registration | csc e Stamp Service Activate | Csc eStamp Id Kaise le 🤍 Join memberships 🤍 FOR MORE INFORMATION VISIT-🤍 -🤍 🤍 आप देश के किसी भी हिस्से में कॉमन सर्विस सेंटर CSC संचालन करते हैं| तो आप इस टेलीग्राम ग्रुप से अवश्य जुड़े-All India CSC common service centre 🤍 website 🤍 🤍 Helo नमस्कार दोस्तों, आपका बहुत बहुत स्वागत है हमारे "Taeget is possible " चैनल में, मैंने यह चैनल मेरे सभी दोस्तों के लिए बनाया है जो टेक्नोलॉजी सरकारी योजना अपना ApnaCSC ,Aadhaar-UCL Aadhar- इंटरनेट टेक्नोलॉजी ,के बारे में अपनी भाषा में जानना चाहते है, "Target is possible" चैनल में आपको रोज़ाना एक नयी वीडियो मिलेगी जहा मैं कोशिश करता रहता हूँ की आपको मोबाइल और कंप्यूटर अपना CSC सरकारी योजना के बारे में कुछ जरुरी बातें बताने की दोस्तों आप सब की वजह से आज हम इस मुकाम पर हैं और दोस्तों मैं आशा करता हूं कि आप इस तरीके से हमारा सपोर्ट करते रहेंगे तो दोस्तों मिलते हैं अगली वीडियो में तब तक के लिए धंयवाद | आपका दिन शुभ रहे ! ► To Watch all our videos, click here 🤍 ► Adhaar ucl all Videos- 🤍 ► Subscribe to our channel, click here - 🤍 ► Facebook: 🤍 ► Twitter: 🤍 ► Google+: 🤍 ► Website: httpS://gadgetsupdateshindi.com ►Hamare saare video, yahan dekhiye - – 🤍 ► Target is possible- ke YouTube channel ko subscribe karne ke liye, yahan click kariye -🤍 #target_is_possible Points Covered in This Video 0:04 CSC E Stamp Service Registration 2:04 csc e Stamp Service Activate 4:07 Csc eStamp Id Kaise le 5:11 e-stamp 6:55 vle E Stamp Service Registration 6:59 csc e Stamp ka id password kaise milega 7:04 vle eStamp password kaise le 7:17 digital seva portal par e stamp Service chalu kaise kare csc vle e-stamp Service chalu kaise kare eStamp id password Registration csc affidevit paper agreement eStamp paper VLE KO e Stamp id password Kaise Milega csc se stamp paper kaise nikale online stamp paper kaise banaye ► हमारे सारे वीडियो, यहाँ देखिये – 🤍 ► अपना CSC के सभी वीडियो, यहाँ देखिये - 🤍 वीडियो पसंद आये तो सब्सक्राइब ,शेयर और लाइक जरूर करें
CSC registration full process 2023 | jan seva kendra | csc center kaise khole | csc id kaise banaye ✅How to login CSC ID first time :- 🤍 ✅TEC exam kaise pass kare :- 🤍 ✅Document resize kaise kare :- 🤍 📍CSC Registration :- 🤍 📍TEC Registration :- 🤍 ✅District manager Contact details :- 📍🤍 📍🤍 🤍Join Telegram Channel:- 🤍 🤍Instagram:- 🤍 🤍Twitter:- 🤍 🤍Facebook Page:- 🤍 Disclaimer- Some contents are used for educational purpose under fair use. Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use. All credit for copyright materiel used in video goes to respected owner. ˜”*°•.˜”*°• Thanks For Watching •°*”˜.•°*”˜ Hashtag:- #cscregistration #csc_registration_online #jansevakendra #cscnewservices2022 #cscnewupdatetoday #cscnewregistration2022 #cscregistration #cscregistration2023 #cscregistration2022 #cscregistration #cscregistration2023tamil #cscregistration2022tamil #cscregistration2022malayalam #cscregistration2022bengali #cscregistrationmestreetaddresskaisedale #cscregistrationkebaadkyakare #cscregistrationproblem #cscregistration2023malayalam #cscregistration2023withoutteccertificate #cscregistrationhonekebaadkyakare #cscregistrationemailotpproblem #cscregistrationprocess #cscregistrationtecnumbernotvalid #cscregistrationand #cscregistration2022telugu #cscregistration2022kannada #cscregistration2023telugu #cscregistrationkabchaluhoga2022 #cscregistration2023kannada #cscregistration2020 #cscapply #cscapplyonline2022 #cscapplyonline2023 #cscapplykarnekebaadkyakare #cscapplyfullprocess #cscapplyassam #cscapplyfullprocessbangla #cscapplyonline2022assam #cscapplyonline2022tamil #cscapplyafterteccertificate #cscapplypancard #cscapplytamil #cscapplyonline2022telugu #cscapply2022 #cscapplykaisekare2023 #cscapplyand #cscapplylatitudeandlongitude #jansevakendra #jansevakendra #jansevakendrakaisele #jansevakendrakholnemekitnapaisalagtahai #jansevakendramekyakyahotahai #jansevakendrakaisele2022 #jansevakendrakakaamkaisesikhe #jansevakendrabusiness #jansevakendrakaisekhole #jansevakendrakholnekeliyekyakyasamanchahiye #jansevakendraincome #jansevakendrakoenglishmeinkyakahatehain #jansevakendraserviceslist #jansevakendramekamkaisekare #jansevakendrasebirthcertificatekaisebanaye #jansevakendramalayalam #jansevakendraand #jansevakendrasepaisekaisenikale #jansevakendrakaisele2023 #jansevakendraidkaisele #jansevakendrakyahotahai #jansevakendrakabannerkaisebanaye #jansevakendrabannerdesign #jansevakendrashopdesign #jansevakendrasepaisekaisekamaye #jansevakendrakisekahatehain #jansevakendraposterkaisebanaye Tags For Refrence:- tech saqib raza,csc id kaise banaye,csc center kaise khole,csc id kaise le,csc registration 2023,how to apply csc registration 2023,csc registration,csc registration kaise kare,csc center kaise khole 2023,how to apply for csc center online,csc id registration,csc new update,csc new services 2023,how to apply csc,csc without tec certificate,csc without exam,csc free registration kaise kare,csc id registration full process,csc id password kaise milega,ipl,how, jan seva kendra kaise le
Welcome to the makkalsevai channel Whatspp number :8682002716 tec applyb : 🤍 csc registration : 🤍 Blogger 🤍 Telegram group 🤍 Instagram 🤍 Facebook Group: 🤍 Disclaimer This channel does not promote or encourage any illegal activities. All contents provided by this channel for GENERAL AND EDUCATIONAL PURPOSE ONLY. Copyright disclaimer under section 107 of the copyright act 1976, allowance is made for "fair use policy" for purposes such as criticism, comment, news reporting,teaching,scholarship and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use. Subscribe,Like ,share and comment Thank you for watching csc registration process 2020,csc registration,csc registration kaise kare,csc registration kaise kare 2020,TEC Number se csc registration kaise kare,tec number csc registration,csc registration apply,csc vle registration,anytimetips,anytime tips,csc registration in tec number,csc vle registration TEc number,online csc apply,online csc apply 2020,csc id password,csc id password kaise le,CSC Registration With TEC Number 2020 csc registration 2020,csc registration,new csc registration,csc registration kaise kare 2020,csc registration kaise kare,csc id kaise banaye,csc id kaise banaye 2020,csc id kaise le,how to apply for csc center online 2020,csc center ke liye apply kaise kare,csc in hindi,csc 2020 new registration,csc 2020 registration,csc,common service centre kaise khole,common service centre kaise le,jan seva kendra kaise le 2020,csc ishan llb,csc center ishan,ishan llb,llb tec registration,tec final exam,tec certificate download,csc registration without tec certificate,tec certificate,csc registration process 2020,csc registration in tec n umber,csc registration kaise kare,csc registratioin,tec number csc registration,csc registration apply,csc vle registration,vle tec registration,social18,csc registration,csc registration 2020 Online Process,OnlineProcess,csc registration process 2020,csc registration,csc registration kaise kare,csc registration kaise kare 2020,tec number se csc registration kaise kare,tec number csc registration,csc registration apply,anytimetips,anytime tips,csc registration in tec number,csc vle registration tec number,online csc apply,online csc apply 2020,csc id password,csc registration with tec number 2020,csc registration 2020,csc new registration 2020Csc,Csc registration,Csc services,Csc new service,Csc registration tamil,Csc registration error,Common service Centre,Tamil Tutorials Tech – தமிழ்,Common service centre registration,Csc vle registration 2018,Csc vle registration tamil,Csc vle tamil,Digital seva portal registration,Digital seva registration,How to Register CSC online Tamil |Digital Seva |CSC VLE | NEW Update | Tamil Tutorials Tech – தமிழ்,csc vle register,csc vle tamil naduhelpinhindi,adhar card,How to Apply For TEC Certificate,CSC TEC Full Exam Process Live,csc registration 2020,apply for tec certificate,tec full exam,tec online exam kaise de,tec certificate registration,tec exam,tec exam kaise de,tec certifcate number kaise le,tec certificate all question,tec certificate aal question and answer in hindi,tec certificate question and answer pdf downloaD,downloat tec question and answer,tec सर्टिफिकेट कैसे आवेदन करेhelpinhindi,adhar card,How to Apply For TEC Certificate,CSC TEC Full Exam Process Live,csc registration 2020,apply for tec certificate,tec full exam,tec online exam kaise de,tec certificate registration,tec exam,tec exam kaise de,tec certifcate number kaise le,tec certificate all question,tec certificate aal question and answer in hindi,tec certificate question and answer pdf downloaD,downloat tec question and answer,tec सर्टिफिकेट कैसे आवेदन करे csc registration,new csc registration 2020,csc registration kaise kare,csc vle registration 2020,csc aadhar center registration 2020,csc registration kaise kare 2020,how to apply csc registration 2020,csc registration 2020 date,csc registration 2020,csc registration process 2020,csc registration 2020 tamil,csc vle,csc apply online 2020,csc services,how to become csc vle,pmegp,nrlm shg registration,nrlm,csc in tamil,csc,csc apply,tec certificate,tec coursecsc registration,new csc registration 2020,csc registration kaise kare,csc vle registration 2020,csc aadhar center registration 2020,csc registration kaise kare 2020,how to apply csc registration 2020,csc registration 2020 date,csc registration 2020,csc registration process 2020,csc registration 2020 tamil,csc vle,csc apply online 2020,csc services,how to become csc vle,pmegp,nrlm shg registration,nrlm,csc in tamil,csc,csc apply,tec certificate,tec course
► Please Like, Share & Subscribe Subject Go के बेहतरीन वीडियोज टुटोरिअल देखने के लिए नीचे दिए लिंक पर क्लिक कीजये :- ►► 🤍 ►🤍 ►🤍 Watch more videos ►YouTube Course : 🤍 ►YouTube Course From Mobile : 🤍 ► MS Word 2007: 🤍 ►MS Powerpoint 2007: 🤍 ► Mobile: 🤍 ► Computer Tips & Tricks: 🤍 ► Photoshop Complete Tutorials: 🤍 ►Computer Quiz : 🤍 ►G.K. : 🤍 ►Subject Go Saturday and Sunday Comment Box: 🤍 ►Blogging Course : 🤍 ►Website Course : 🤍 ►Internet : 🤍 ► हमसे संपर्क करें Contact us: help🤍Subjectgo.com ► Pixabook.com: 🤍 ► हमारे फेसबुक पेज को Like करें :🤍 ► YouTube चैनल Subscribe करें :🤍 ►Twitter पर Follow करें : 🤍 ► Pinterest पर फॉलो करें :🤍 _ Subject Go चैनल के माध्यम से आप यहाँ कंप्यूटर कोर्स, मोबाइल, GK, मोटिवेशनल कहानी, थॉट, भारत और विश्व से सम्बन्धी रोचक जानकारी फ्री में सीख सकते हैं, आप हमारे वेबसाइट पर भी सभी तरह के फ्री कोर्स सीख सकते हैं | हमारा हर संभव प्रयास है कि हम कंप्यूलटर तकनीक से जुडी हर प्रकार की जानकारी आपको उपलब्ध करायें | _ ►► Our Website: 🤍 ► Our Technology blog: 🤍 In Case of Objection to any video content on this Channel, please contact us: help🤍Subjectgo.com
hi , namaskar dosto, swagat hai aap sabhi ka apne official youtube channel csc helper aur me hu om soni aaj aap sabhi se btana wala hu ki aap log csc app kaise open kre jo ki bahut smsya rahi hai es video ko pura dekhiye Dear VLEs and my youtube family #cscappopenkyonhihorhahai #DigitalIndia #Thehelppoint #csc #cscapp #cscapp2021 #cscappregistartion2021 #cscappnotsendmessage2021 #cscappregistraion2021 🟠 𝐏𝐫𝐞𝐬𝐞𝐧𝐭𝐢𝐧𝐠 𝐛𝐲 » CSC Helper 🟤 𝐓𝐡𝐢𝐬 𝐯𝐢𝐝𝐞𝐨 𝐢𝐬 𝐦𝐚𝐤𝐢𝐧𝐠 𝐛𝐲» 𝐨𝐦 𝐬𝐨𝐧𝐢 _ ⚪𝐬𝐨 𝐠𝐮𝐲𝐬 𝐝𝐨𝐧'𝐭 𝐟𝐨𝐫𝐠𝐞𝐭 𝐭𝐨 𝐟𝐚𝐥𝐥𝐨𝐰 𝐦𝐞 𝐨𝐧 𝐬𝐨𝐜𝐢𝐚𝐥 𝐦𝐞𝐝𝐢𝐚 🟢𝐒𝐞𝐞 𝐰𝐚𝐭𝐜𝐡 𝐦𝐲 𝐀𝐥𝐥 𝐯𝐢𝐝𝐞𝐨𝐬» video:-🤍 Join this channel to get access to membership : 🤍 Facebook-🤍 Telegram-. 🤍 _ अधिक जानकारी हेतु:- 🔴 𝐕𝐢𝐬𝐢𝐭» 🤍 🟣 𝐈𝐧𝐬𝐭𝐚𝐠𝐫𝐚𝐦» 🤍 My Gears:- Photo printer- 🤍 Mantra device- 🤍 Laptop cooler- 🤍 Morpho device- 🤍 Canon camera- 🤍 camera tripod- 🤍 Lamination- 🤍 Mobile tripod- 🤍 Light Stand - 🤍 Printer Ink- 🤍 Printer- 🤍 Keyboard- 🤍 Laptop- 🤍 Mouse- 🤍 USB Hub- 🤍 Router- 🤍 Full T-Shirt- 🤍 MiC- 🤍 Sandisk- 🤍 TAGS:- #cscappnotopen2021 #CSCHelper 𝐓hanks for supporting 😘😘 #Keeploving #keepsupporting
CSC मध्ये कोणत्या सर्व्हिसेस? काय काय करू शकता? हेच आज आपण या व्हिडिओ मध्ये पाहणार आहोत. 🔴👉 आमच्याशी बोला Telegram Group वर join करा - 🤍 🔴👉 आमच्याशी बोला Instagram वर क्लिक करा - 🤍 ज्यांच्याकडे csc id आहे किंवा नाही त्यांनी पण हा व्हिडिओ पहा. चॅनेल ला subscribe करायला विसरू नका. #CSC_SERVICES 👇लिंक्स 🖇️👇 हा video संपूर्ण पहा आणि सर्व process तुम्हाला येथे मिळेल. 🔴CSC REGISTRATION 2021 कसे करावे - 🤍 🔴 आधार exam Registration कसे करावे - 🤍 🔴 POLICE VERIFICATION कसे करावे - 🤍 🔴 Laptop कोणता लागणार - 🤍 👇TOPIC COVERED👇 1. CSC SERVICES 2021 2. AADHAR CENTER CSC 3. CSC UCL 4. RECHARGE CSC 5. FLIGHT/BUS/TRAIN BOOKING 6. PAN CARD 7. ELECTRICITY 8. LOAN 9. INSURANCE 10. PRADHANMANTRI Yojana 🌍👇Follow me on Social Media👇🌍 Website - 🤍 Facebook - 🤍 YouTube - 🤍 Instagram - 🤍 Twitter - 🤍 #LIST_BANNER Disclaimer - some Contents use for Educational purpose only. Copyright Disclaimer Under Section 107 of the Copyright Act 1976, allowance is made for "fair use" for purposes such as criticism, comment, news reporting, teaching, scholarship, and research. Fair use is a use permitted by copyright statute that might otherwise be infringing. Non-profit, educational or personal use tips the balance in favor of fair use. All Credit for copyright material used in video goes to the respective owners.
.svg){kind=small}
